(data stored in ACNUC7421 zone)

EMBL: CP000094.PE213

CP000094.PE213       Location/Qualifiers
FT   CDS             complement(256125..257069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0215"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71959"
FT                   /db_xref="GOA:Q3KJU7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU7"
FT                   /protein_id="ABA71959.1"
FT                   /translation="MHIDLRQLRHFIALAEQRSFVAGAQAVNLSQSAFSRSIQALEHSV
FT                   GCQLVDRGRKELPPTKQGQVLLEHARRLVSGAQQMANEISQFNGLEAGELRFGCGPAPA
FT                   AGLIPRAIGSFIGRYPKARVHYQVDDWQSLSKRLLSEEFEFFVADTRHFEADPDYLTHR
FT                   LRPRKWHFCCRAGHPLGAFERVTAEQLMSYPLAVSIRPPNLRKVIVDLSGRPDFVPNVE
FT                   CENSASLLGVVLRSDAIGIVGAYSDALHQARGELVCLKVEGLADDLEELYTRYGIVSRA
FT                   GYRLSPLAEAMIEQIKAIDAVEEEVCSLANLAV"
     MHIDLRQLRH FIALAEQRSF VAGAQAVNLS QSAFSRSIQA LEHSVGCQLV DRGRKELPPT        60
     KQGQVLLEHA RRLVSGAQQM ANEISQFNGL EAGELRFGCG PAPAAGLIPR AIGSFIGRYP       120
     KARVHYQVDD WQSLSKRLLS EEFEFFVADT RHFEADPDYL THRLRPRKWH FCCRAGHPLG       180
     AFERVTAEQL MSYPLAVSIR PPNLRKVIVD LSGRPDFVPN VECENSASLL GVVLRSDAIG       240
     IVGAYSDALH QARGELVCLK VEGLADDLEE LYTRYGIVSR AGYRLSPLAE AMIEQIKAID       300
     AVEEEVCSLA NLAV                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page