(data stored in ACNUC7421 zone)

EMBL: CP000094.PE217

CP000094.PE217       Location/Qualifiers
FT   CDS             261626..262351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0219"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71963"
FT                   /db_xref="GOA:Q3KJU3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU3"
FT                   /protein_id="ABA71963.1"
FT                   /translation="MTLLASPLESIESAVIWLLVVFSVATWGLALLKAVQFGRLKAQDR
FT                   KFHKRFWAASSLDSAAELSETQPGAAARVAQAGYAAIQVGEAPQANDLSQAINHQDRLE
FT                   RALRQQIVRERRSLETGLAVVASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVA
FT                   GPIGAALVATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSSFRVLIH
FT                   PTAHKAAAQGNATKVKEAS"
     MTLLASPLES IESAVIWLLV VFSVATWGLA LLKAVQFGRL KAQDRKFHKR FWAASSLDSA        60
     AELSETQPGA AARVAQAGYA AIQVGEAPQA NDLSQAINHQ DRLERALRQQ IVRERRSLET       120
     GLAVVASIGS TSPFIGLFGT VWGIMEALKG ISAAGSASLE TVAGPIGAAL VATGVGIAVA       180
     VPAVLVYNYF LRRLKLTAAD LDDFAHDFYS LAQKSSFRVL IHPTAHKAAA QGNATKVKEA       240
     S                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page