(data stored in ACNUC7421 zone)

EMBL: CP000094.PE218

CP000094.PE218       Location/Qualifiers
FT   CDS             262353..262754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0220"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71964"
FT                   /db_xref="GOA:Q3KJU2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU2"
FT                   /protein_id="ABA71964.1"
FT                   /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNAIPIN
FT                   LPKTEAVAPVEQKDPLVVSIDGAGKLFINKDEIQPDLLEFNLKSAKAKDPEVRVQLQAD
FT                   DGVNYGEVARAMASIERAGITKLSVITAR"
     MAFSTQDSDE VLSEINVTPL VDVMLVLLVV FIVTAPLLTN AIPINLPKTE AVAPVEQKDP        60
     LVVSIDGAGK LFINKDEIQP DLLEFNLKSA KAKDPEVRVQ LQADDGVNYG EVARAMASIE       120
     RAGITKLSVI TAR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page