(data stored in ACNUC7421 zone)

EMBL: CP000094.PE220

CP000094.PE220       Location/Qualifiers
FT   CDS             263562..264494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0222"
FT                   /product="putative sigma-54 dependent regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71966"
FT                   /db_xref="GOA:Q3KJU0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU0"
FT                   /protein_id="ABA71966.1"
FT                   /translation="MSLETFGQPLLTFPDAEKSPLSIRAKALVFVDPRSRQLREEMAQL
FT                   APRSISVLIRGETGTGKELLARHIHRASDRSGLFVSVNCGAISPTYADAELFGYAAGSY
FT                   SGSASSRAGWFGSANGGTLYLDEIGDLPLPIQIKLLSALENHEVTRVGAHQPSPVDVRL
FT                   VAATSIDLAQAVAAGKFHERLYHYLSEGHLELPALRARVGDILSLAEYFLGIYSQRLDL
FT                   PVPLISEAAQQVLEQHSWPGNTRELENVIHFALLVSTGDEILPEHLNLPEVSGPQVQIE
FT                   RQVASVSLNGTVDERKALKEWLLSLSEAL"
     MSLETFGQPL LTFPDAEKSP LSIRAKALVF VDPRSRQLRE EMAQLAPRSI SVLIRGETGT        60
     GKELLARHIH RASDRSGLFV SVNCGAISPT YADAELFGYA AGSYSGSASS RAGWFGSANG       120
     GTLYLDEIGD LPLPIQIKLL SALENHEVTR VGAHQPSPVD VRLVAATSID LAQAVAAGKF       180
     HERLYHYLSE GHLELPALRA RVGDILSLAE YFLGIYSQRL DLPVPLISEA AQQVLEQHSW       240
     PGNTRELENV IHFALLVSTG DEILPEHLNL PEVSGPQVQI ERQVASVSLN GTVDERKALK       300
     EWLLSLSEAL                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page