(data stored in ACNUC7421 zone)

EMBL: CP000094.PE221

CP000094.PE221       Location/Qualifiers
FT   CDS             264659..265456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0223"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71967"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT9"
FT                   /protein_id="ABA71967.1"
FT                   /translation="MKKVLLFTALAAALTASLAQAGEKLVVAATPVPHAEILELIKPTL
FT                   AKEGVDLEIKVFTDYVQPNVQVGEKRLDANYFQTKPYLDSFNAGKYKDDKAKYLVTVQG
FT                   VHVEPFGGYSSKYKTLAELPDGATIAIPNEGSNSGRALILLQKAGLIELKDPKNALATP
FT                   KDIAKNPHNFKFKELESALLPRVLKEVDLDMINTNYALEAKLNPTKDALVIEGADSPYV
FT                   NFLVAREDNKNSDAIKKLAAALTSPEVKAFIEKKYNGAVLPAF"
     MKKVLLFTAL AAALTASLAQ AGEKLVVAAT PVPHAEILEL IKPTLAKEGV DLEIKVFTDY        60
     VQPNVQVGEK RLDANYFQTK PYLDSFNAGK YKDDKAKYLV TVQGVHVEPF GGYSSKYKTL       120
     AELPDGATIA IPNEGSNSGR ALILLQKAGL IELKDPKNAL ATPKDIAKNP HNFKFKELES       180
     ALLPRVLKEV DLDMINTNYA LEAKLNPTKD ALVIEGADSP YVNFLVARED NKNSDAIKKL       240
     AAALTSPEVK AFIEKKYNGA VLPAF                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page