(data stored in ACNUC7421 zone)

EMBL: CP000094.PE223

CP000094.PE223       Location/Qualifiers
FT   CDS             265919..266584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0225"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71969"
FT                   /db_xref="GOA:Q3KJT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT7"
FT                   /protein_id="ABA71969.1"
FT                   /translation="MTFDYAFILSTLPAFLKAVGVTLQVGLIAIGTSLLVALLNATILV
FT                   FRTPYLQKLVGLYVELARNTPLLIQLFFVYFALPALGIKVSGFTAAIITMTFLGGAYLT
FT                   EVLRAGVDAVPQAQLESGRSIGLSHGQLLRYVILPQAGILSLPSLFANFIFLLKETTVV
FT                   SAVAVPEILYTTKSYIALYYKTYEMLAVLTLICVLLFLPLSLLLSRLERRLQHGQFGS"
     MTFDYAFILS TLPAFLKAVG VTLQVGLIAI GTSLLVALLN ATILVFRTPY LQKLVGLYVE        60
     LARNTPLLIQ LFFVYFALPA LGIKVSGFTA AIITMTFLGG AYLTEVLRAG VDAVPQAQLE       120
     SGRSIGLSHG QLLRYVILPQ AGILSLPSLF ANFIFLLKET TVVSAVAVPE ILYTTKSYIA       180
     LYYKTYEMLA VLTLICVLLF LPLSLLLSRL ERRLQHGQFG S                           221
//

If you have problems or comments...

PBIL Back to PBIL home page