(data stored in ACNUC7421 zone)

EMBL: CP000094.PE224

CP000094.PE224       Location/Qualifiers
FT   CDS             266595..267224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0226"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71970"
FT                   /db_xref="GOA:Q3KJT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT6"
FT                   /protein_id="ABA71970.1"
FT                   /translation="MSLPQLAKGAGQTLSISFLSIAISTVGGVLYGVLRTLNVRWLNAL
FT                   LRIYLELFRAIPVLVWLYLLFFGLPIFFGLSLPSFWCAVLVLSLWGASEVGEVARGALH
FT                   SLPRGQREAGLSIGLNAAQLYGYVLLPQALKRMTPPTINVYTRIIKTSSLAVLIGVVDV
FT                   IKVGQQIIERTYESVLIYGALFLFFFFICYPLSAASRVLERRWTQA"
     MSLPQLAKGA GQTLSISFLS IAISTVGGVL YGVLRTLNVR WLNALLRIYL ELFRAIPVLV        60
     WLYLLFFGLP IFFGLSLPSF WCAVLVLSLW GASEVGEVAR GALHSLPRGQ REAGLSIGLN       120
     AAQLYGYVLL PQALKRMTPP TINVYTRIIK TSSLAVLIGV VDVIKVGQQI IERTYESVLI       180
     YGALFLFFFF ICYPLSAASR VLERRWTQA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page