(data stored in ACNUC7421 zone)

EMBL: CP000094.PE225

CP000094.PE225       Location/Qualifiers
FT   CDS             267221..268018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0227"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71971"
FT                   /db_xref="GOA:Q3KJT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT5"
FT                   /protein_id="ABA71971.1"
FT                   /translation="MSALIEFQGFNKFFGEQQVLKGIDLQVKSGEVIVVLGPSGCGKST
FT                   LLRCLNGLETAHSGSLKFAGRELLDKATDWREVRQQIGMVFQSYHLFPHMSVLDNLLLG
FT                   PLKVQKRERREAQQQAEALLERVGLADKCDAFPRQLSGGQQQRIAIVRSLCMNPRVMLF
FT                   DEVTAALDPEMVKEVLEVIQGLAREGMTLLIVTHEMAFARAVADRIVFMDAGRILEQNP
FT                   PELFFTNPQTARAQQFLEKFSYVEALTSTTSPTTSQTKELELP"
     MSALIEFQGF NKFFGEQQVL KGIDLQVKSG EVIVVLGPSG CGKSTLLRCL NGLETAHSGS        60
     LKFAGRELLD KATDWREVRQ QIGMVFQSYH LFPHMSVLDN LLLGPLKVQK RERREAQQQA       120
     EALLERVGLA DKCDAFPRQL SGGQQQRIAI VRSLCMNPRV MLFDEVTAAL DPEMVKEVLE       180
     VIQGLAREGM TLLIVTHEMA FARAVADRIV FMDAGRILEQ NPPELFFTNP QTARAQQFLE       240
     KFSYVEALTS TTSPTTSQTK ELELP                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page