(data stored in ACNUC7421 zone)

EMBL: CP000094.PE227

CP000094.PE227       Location/Qualifiers
FT   CDS             complement(268890..270050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71973"
FT                   /db_xref="GOA:Q3KJT3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT3"
FT                   /protein_id="ABA71973.1"
FT                   /translation="MLKTLAVANYRSINKLVIPLGRLNLITGPNGSGKSNLYRALRLLA
FT                   ETAQGGVVNALAREGGLDSTFWAGPETISRRMRNGEVPIQSTVRQGVKRLRLGFAGEDF
FT                   SYSIALGLPEPSLSYFSLDPEIKKECIWAGPLYRPASLLVDRDGPMIRTRDGRSWDVLA
FT                   QHTPNFDSLFDQVGSLRTSPEVFQMREFIRRWRFYDHFRSDADAPVRQPQLGTRTPVLH
FT                   HDGRDLAAALQTIREIGDPEALQAAISDAFPGARLNIAPLAGGRFAIEFFQEGLLRPLS
FT                   AAELSDGTLRYLLLVAALLTPRPPSLMVLNEPETSLHPDLLPALARLIIRVSEQCQVWV
FT                   VSHARRLISALQEDPECNCIVLEKTLGQTGIVGQRVLDEPAWNWPD"
     MLKTLAVANY RSINKLVIPL GRLNLITGPN GSGKSNLYRA LRLLAETAQG GVVNALAREG        60
     GLDSTFWAGP ETISRRMRNG EVPIQSTVRQ GVKRLRLGFA GEDFSYSIAL GLPEPSLSYF       120
     SLDPEIKKEC IWAGPLYRPA SLLVDRDGPM IRTRDGRSWD VLAQHTPNFD SLFDQVGSLR       180
     TSPEVFQMRE FIRRWRFYDH FRSDADAPVR QPQLGTRTPV LHHDGRDLAA ALQTIREIGD       240
     PEALQAAISD AFPGARLNIA PLAGGRFAIE FFQEGLLRPL SAAELSDGTL RYLLLVAALL       300
     TPRPPSLMVL NEPETSLHPD LLPALARLII RVSEQCQVWV VSHARRLISA LQEDPECNCI       360
     VLEKTLGQTG IVGQRVLDEP AWNWPD                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page