(data stored in ACNUC7421 zone)

EMBL: CP000094.PE235

CP000094.PE235       Location/Qualifiers
FT   CDS             complement(279433..280242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0237"
FT                   /product="putative amino acid ABC transport system,
FT                   exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71981"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS5"
FT                   /protein_id="ABA71981.1"
FT                   /translation="MTKKLLSHPVKALALAFGLFSSAVFAADAPLKIGTTAAFAIPLEA
FT                   AVEEASKQGLKVELVEFTDWIAPNVSLAAGDIDVNYFQHIPFLENAKAASGFDLVPFAP
FT                   GIINNVGLYSKKYKSFDELPEGASVAIANDPINSGRGLQLLAKAGLITLKPGVGYKATE
FT                   DDIVANPKKIKILQVEAVQLVRAYDDADLVQGYPAYIRLAKTFDAGSALLFDGLDHKEY
FT                   VIQFVIQPKSKTDPRLIKFVDIYQHSPAVRAALDKAHGKLYQAGWES"
     MTKKLLSHPV KALALAFGLF SSAVFAADAP LKIGTTAAFA IPLEAAVEEA SKQGLKVELV        60
     EFTDWIAPNV SLAAGDIDVN YFQHIPFLEN AKAASGFDLV PFAPGIINNV GLYSKKYKSF       120
     DELPEGASVA IANDPINSGR GLQLLAKAGL ITLKPGVGYK ATEDDIVANP KKIKILQVEA       180
     VQLVRAYDDA DLVQGYPAYI RLAKTFDAGS ALLFDGLDHK EYVIQFVIQP KSKTDPRLIK       240
     FVDIYQHSPA VRAALDKAHG KLYQAGWES                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page