(data stored in ACNUC7421 zone)

EMBL: CP000094.PE240

CP000094.PE240       Location/Qualifiers
FT   CDS             complement(285581..286330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0242"
FT                   /product="L-cystine ABC transporter ATP-binding protein /
FT                   Diaminopimelate ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71986"
FT                   /db_xref="GOA:Q3KJS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS0"
FT                   /protein_id="ABA71986.1"
FT                   /translation="MIVVEKLTKQFKGQVVLNGIDLEVKEGEVVAIIGPSGSGKTTFLR
FT                   CLNFLEEPTSGRIKVGEIEIDTSRPLNQQQNLVRNLRQHVGFVFQNFNLFPHRTALENV
FT                   IEGPIVVKKTPRDAAIALGKKLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAMEPEV
FT                   ILFDEPTSALDPELVGEVLATIRGLAEEKRTMVIVTHEMAFARDVANRVVFFDKGVIVE
FT                   QGEAKALFANPKEERTRQFLSKFRNNG"
     MIVVEKLTKQ FKGQVVLNGI DLEVKEGEVV AIIGPSGSGK TTFLRCLNFL EEPTSGRIKV        60
     GEIEIDTSRP LNQQQNLVRN LRQHVGFVFQ NFNLFPHRTA LENVIEGPIV VKKTPRDAAI       120
     ALGKKLLAKV GLAGKEDAYP RRLSGGQQQR VAIARALAME PEVILFDEPT SALDPELVGE       180
     VLATIRGLAE EKRTMVIVTH EMAFARDVAN RVVFFDKGVI VEQGEAKALF ANPKEERTRQ       240
     FLSKFRNNG                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page