(data stored in ACNUC7421 zone)

EMBL: CP000094.PE242

CP000094.PE242       Location/Qualifiers
FT   CDS             complement(287000..287800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0244"
FT                   /product="Diaminopimelate-binding protein /
FT                   L-cystine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71988"
FT                   /db_xref="GOA:Q3KJR8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR8"
FT                   /protein_id="ABA71988.1"
FT                   /translation="MILSALRRNLLVGSLGLALSAGLLGQAVAGEQLQQIKDKGVINVG
FT                   LEGTYPPFSFVDADGKLSGFEVELSEALAKKLGVKAKIQPTKWDGILAALESKRLDVVV
FT                   NQVTISEERKKKYDFSEPYTVSGIQALVLKDKAAALNIKSAADLSGKKVGVGLGTNYEQ
FT                   WVRANVPGADVRTYDDDPTKFADLNNGRTDAILIDRLAALEYAQKAPKTVAAGEAFSRQ
FT                   EAGIALRKGEPELLAAVNKALDELRADGTLEKLSKKYFNADVTQ"
     MILSALRRNL LVGSLGLALS AGLLGQAVAG EQLQQIKDKG VINVGLEGTY PPFSFVDADG        60
     KLSGFEVELS EALAKKLGVK AKIQPTKWDG ILAALESKRL DVVVNQVTIS EERKKKYDFS       120
     EPYTVSGIQA LVLKDKAAAL NIKSAADLSG KKVGVGLGTN YEQWVRANVP GADVRTYDDD       180
     PTKFADLNNG RTDAILIDRL AALEYAQKAP KTVAAGEAFS RQEAGIALRK GEPELLAAVN       240
     KALDELRADG TLEKLSKKYF NADVTQ                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page