(data stored in ACNUC7421 zone)

EMBL: CP000094.PE25

CP000094.PE25        Location/Qualifiers
FT   CDS             complement(27584..28501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0025"
FT                   /product="putative ABC transport system, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71769"
FT                   /db_xref="GOA:Q3KKD7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD7"
FT                   /protein_id="ABA71769.1"
FT                   /translation="MVKLSTVVTVSLLALGSASAFAESCDTVKMADPGWSDIAATNAIT
FT                   GFLLDGMGYKAKVDTLAVPITFGGLKDGQVDVFLGNWMPAQQGFYDKFVATGDVTQLAK
FT                   NLDGTEFTLAVPDYVWDAGVHNFADLNKYADKFEKKIYGIGSGAPANISLQEIIKKNDF
FT                   DLGQWKLIESSEQAMLAEVSRAVKKQKFVTFLGWTPHPMNVQLKMHYLKGGEKYFGDTG
FT                   SVYTLTRKGYAEACPNVGKLLTNLAFTQEMENSIMAEVVNKKVSNAEAVKAWIKANPGV
FT                   LDKWLDGVKTVDGKDALPAVKAKL"
     MVKLSTVVTV SLLALGSASA FAESCDTVKM ADPGWSDIAA TNAITGFLLD GMGYKAKVDT        60
     LAVPITFGGL KDGQVDVFLG NWMPAQQGFY DKFVATGDVT QLAKNLDGTE FTLAVPDYVW       120
     DAGVHNFADL NKYADKFEKK IYGIGSGAPA NISLQEIIKK NDFDLGQWKL IESSEQAMLA       180
     EVSRAVKKQK FVTFLGWTPH PMNVQLKMHY LKGGEKYFGD TGSVYTLTRK GYAEACPNVG       240
     KLLTNLAFTQ EMENSIMAEV VNKKVSNAEA VKAWIKANPG VLDKWLDGVK TVDGKDALPA       300
     VKAKL                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page