(data stored in ACNUC7421 zone)

EMBL: CP000094.PE252

CP000094.PE252       Location/Qualifiers
FT   CDS             complement(299890..300729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0254"
FT                   /product="taurine ABC transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71998"
FT                   /db_xref="GOA:Q3KJQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ8"
FT                   /protein_id="ABA71998.1"
FT                   /translation="MSSYDVSATAVKPAATSVVIPVRRSLSTRWISLLTLFALLVIWWA
FT                   VTASGLIEPLFLPPPSAVLQKGWLLATTGYMDSTLWQHLGASLSRIGLGLGFAILTAVP
FT                   VGIAIGANRIARGVLDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAPIAI
FT                   ATATGVRTVDPAKLRAAQSLGATRAQLIRHVILPSALPDILTGVRIGLGVGWSTLVAAE
FT                   LIAATSGLGFMVQSAAQFLVTDVVVLGILVIALIAFAMEMGLRALQRKLVPWHGQAH"
     MSSYDVSATA VKPAATSVVI PVRRSLSTRW ISLLTLFALL VIWWAVTASG LIEPLFLPPP        60
     SAVLQKGWLL ATTGYMDSTL WQHLGASLSR IGLGLGFAIL TAVPVGIAIG ANRIARGVLD       120
     PLIEFYRPIP PLAYLPLIVI WCGIGELSKV LLIYLAIFAP IAIATATGVR TVDPAKLRAA       180
     QSLGATRAQL IRHVILPSAL PDILTGVRIG LGVGWSTLVA AELIAATSGL GFMVQSAAQF       240
     LVTDVVVLGI LVIALIAFAM EMGLRALQRK LVPWHGQAH                              279
//

If you have problems or comments...

PBIL Back to PBIL home page