(data stored in ACNUC7421 zone)

EMBL: CP000094.PE254

CP000094.PE254       Location/Qualifiers
FT   CDS             complement(301537..302514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0256"
FT                   /product="taurine ABC transport system, substrate-binding
FT                   periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72000"
FT                   /db_xref="GOA:Q3KJQ6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ6"
FT                   /protein_id="ABA72000.1"
FT                   /translation="MKLNFPLRLLAVASLAAASFLAQAADLTVAYQTTVDPAKVAQADG
FT                   AYEKATKADINWRKFDNGADIIAAIASGDVQIGYLGSSPLTAAITRKVPVETFLIATQI
FT                   GAAEALVARDGSGIKTPQDLVGKKIAVPFVSTGHYSLLAALKHWNIDPSKVTVLNLAPP
FT                   AIIAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAKFGAPTFDAWIVRKDFAEKHP
FT                   EIVTAFAKVTLDAYADYRKDPKAWLANQSNVDKLVKLSGAKASDIPLLLQGNVYPLAAD
FT                   QVSDLGAPTTKAITDTATFLKEQGKVEAVLPDYAPYVSAKYITN"
     MKLNFPLRLL AVASLAAASF LAQAADLTVA YQTTVDPAKV AQADGAYEKA TKADINWRKF        60
     DNGADIIAAI ASGDVQIGYL GSSPLTAAIT RKVPVETFLI ATQIGAAEAL VARDGSGIKT       120
     PQDLVGKKIA VPFVSTGHYS LLAALKHWNI DPSKVTVLNL APPAIIAAWK RGDIDATYVW       180
     DPALGVAKEN GKVLITSGEL AKFGAPTFDA WIVRKDFAEK HPEIVTAFAK VTLDAYADYR       240
     KDPKAWLANQ SNVDKLVKLS GAKASDIPLL LQGNVYPLAA DQVSDLGAPT TKAITDTATF       300
     LKEQGKVEAV LPDYAPYVSA KYITN                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page