(data stored in ACNUC7421 zone)

EMBL: CP000094.PE260

CP000094.PE260       Location/Qualifiers
FT   CDS             complement(309828..310733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0262"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72006"
FT                   /db_xref="GOA:Q3KJQ0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJQ0"
FT                   /protein_id="ABA72006.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGTERGHEMVVIDTLRAYMNIASHK
FT                   PQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSL
FT                   QLLSRRGIGLPVTGFAHSPDDIPDLIDMVNGAPLVIKVLEGTQGIGVVLCETATAAESV
FT                   IEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIAAMKRQAKPGEFRSNLHRGGSASL
FT                   IKITPEERMTALRAAKVMGLAVAGVDILRSNHGPLVMEVNSSPGLEGIETTTGKNVAGI
FT                   IIEHLEKNGGPNMTRTKGKG"
     MKIAVLSRNP RLYSTRRLVE AGTERGHEMV VIDTLRAYMN IASHKPQIHY RGKPLEGFDA        60
     VIPRIGASVT FYGCAVLRQF EMMGVFPLNE SVAIARSRDK LRSLQLLSRR GIGLPVTGFA       120
     HSPDDIPDLI DMVNGAPLVI KVLEGTQGIG VVLCETATAA ESVIEAFMGL KQNIMVQEYI       180
     KEAGGADIRC FVVGDKVIAA MKRQAKPGEF RSNLHRGGSA SLIKITPEER MTALRAAKVM       240
     GLAVAGVDIL RSNHGPLVME VNSSPGLEGI ETTTGKNVAG IIIEHLEKNG GPNMTRTKGK       300
     G                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page