(data stored in ACNUC7421 zone)

EMBL: CP000094.PE261

CP000094.PE261       Location/Qualifiers
FT   CDS             complement(310730..311209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP9"
FT                   /protein_id="ABA72007.1"
FT                   /translation="MKTFDHLTVIGLREWVALPDLGVAGLRAKIDTGASTSSLHATDIE
FT                   PFERDGEKWVRFTAHLGTVVQLRHRRCEAPLVARKTIKSSNGQAQVRYVISTTLALGDR
FT                   VWPIEFTLACRKSMRYRLLLGSKALIDGQLVVNPGIKYVQDKPVFPVSTSSTGVA"
     MKTFDHLTVI GLREWVALPD LGVAGLRAKI DTGASTSSLH ATDIEPFERD GEKWVRFTAH        60
     LGTVVQLRHR RCEAPLVARK TIKSSNGQAQ VRYVISTTLA LGDRVWPIEF TLACRKSMRY       120
     RLLLGSKALI DGQLVVNPGI KYVQDKPVFP VSTSSTGVA                              159
//

If you have problems or comments...

PBIL Back to PBIL home page