(data stored in ACNUC7421 zone)

EMBL: CP000094.PE264

CP000094.PE264       Location/Qualifiers
FT   CDS             complement(312596..313396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0266"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72010"
FT                   /db_xref="GOA:Q3KJP6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP6"
FT                   /protein_id="ABA72010.1"
FT                   /translation="MNNPGLFQSRWNLGRLVLCNVVPLALLAFWLWPTGQMLCVIFDEW
FT                   LFRSLNAPLASNPIWLHIWAIASLRPFDIVVGVILLMLLIKGDWVFRAIDVRRAFFGFF
FT                   SILLLMVVIRALFSKFSDHMGWQHSSPSMVLEGAVHISDYFPHLEKTWELKDRSSQSFP
FT                   GDHASVLLIWALFMGVFSRTAGQFLVIWGLALLFMLPRLVAGAHWGQDDYIGGMLLAVW
FT                   ALGWGYYTPFAYHAANFWLKVTAPVFRLLGKLPMVSRMSVVSAQ"
     MNNPGLFQSR WNLGRLVLCN VVPLALLAFW LWPTGQMLCV IFDEWLFRSL NAPLASNPIW        60
     LHIWAIASLR PFDIVVGVIL LMLLIKGDWV FRAIDVRRAF FGFFSILLLM VVIRALFSKF       120
     SDHMGWQHSS PSMVLEGAVH ISDYFPHLEK TWELKDRSSQ SFPGDHASVL LIWALFMGVF       180
     SRTAGQFLVI WGLALLFMLP RLVAGAHWGQ DDYIGGMLLA VWALGWGYYT PFAYHAANFW       240
     LKVTAPVFRL LGKLPMVSRM SVVSAQ                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page