(data stored in ACNUC7421 zone)

EMBL: CP000094.PE267

CP000094.PE267       Location/Qualifiers
FT   CDS             complement(316192..316491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0269"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72013"
FT                   /db_xref="GOA:Q3KJP3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP3"
FT                   /protein_id="ABA72013.1"
FT                   /translation="MEMTMSKFFDELMESVQEMDEIVRGERTPSREFHVDALQVKEIRK
FT                   ATGLTQAKFAALIDVQLGTLRNWEQGRREPTGPAKALLKAIHNDPVHVLNALAH"
     MEMTMSKFFD ELMESVQEMD EIVRGERTPS REFHVDALQV KEIRKATGLT QAKFAALIDV        60
     QLGTLRNWEQ GRREPTGPAK ALLKAIHNDP VHVLNALAH                               99
//

If you have problems or comments...

PBIL Back to PBIL home page