(data stored in ACNUC7421 zone)

EMBL: CP000094.PE268

CP000094.PE268       Location/Qualifiers
FT   CDS             complement(316482..316796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72014"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP2"
FT                   /protein_id="ABA72014.1"
FT                   /translation="MIFIETRIFTRRVKELLDDDTYAAFQKQLVVSPSIGDVIEGTGGI
FT                   RKTRIAAKGHGKRGGARVIYYHFVSASQIGLLMIYPKNEQHDLSSDERKALKVLIEKWR
FT                   "
     MIFIETRIFT RRVKELLDDD TYAAFQKQLV VSPSIGDVIE GTGGIRKTRI AAKGHGKRGG        60
     ARVIYYHFVS ASQIGLLMIY PKNEQHDLSS DERKALKVLI EKWR                        104
//

If you have problems or comments...

PBIL Back to PBIL home page