(data stored in ACNUC7421 zone)

EMBL: CP000094.PE269

CP000094.PE269       Location/Qualifiers
FT   CDS             complement(316908..317207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72015"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP1"
FT                   /protein_id="ABA72015.1"
FT                   /translation="MKLWNQFPNDRYRPLDTNLTDTKPLVIDTEADPQDILECAVQRLR
FT                   ASSDLLQTLYCLCFKHADVEDIPHITHALYLLTKDGFDLLQVAQQRMLNWKAPV"
     MKLWNQFPND RYRPLDTNLT DTKPLVIDTE ADPQDILECA VQRLRASSDL LQTLYCLCFK        60
     HADVEDIPHI THALYLLTKD GFDLLQVAQQ RMLNWKAPV                               99
//

If you have problems or comments...

PBIL Back to PBIL home page