(data stored in ACNUC7421 zone)

EMBL: CP000094.PE274

CP000094.PE274       Location/Qualifiers
FT   CDS             322487..323710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0276"
FT                   /product="putative fatty acid degradation protein (possibly
FT                   trifunctional)"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72020"
FT                   /db_xref="GOA:Q3KJN6"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN6"
FT                   /protein_id="ABA72020.1"
FT                   /translation="MSQTSFAIQQAAVIGAGTMGRGIVMCLANAGVSVQWVDNNPQMLE
FT                   QALSSVAETYAHNVRQGRIDQAEADARIARVSKAADYVAIRNVDLVIEAVYENLELKQK
FT                   IFRELDGVLKPEALLASNTSALDIDAIAAATRRPTQVLGLHFFSPAHIMKLLEIVRGAQ
FT                   TAPAVLEAALELGKRMGKVSVVSGNCHGFIGNRMLHPYVLEARKMLLEGAYPHQVDAAL
FT                   QSFGFAMGPFRMYDVVGIDLEWRARELAGKGQDAPEVQVDNRLCEQGRFGQKSGNGYYH
FT                   YEPGSRQAEHDPEVDALVLSVSEGLGFHRRDIGSEEILERCLLALVNEGAKILQEGIAE
FT                   SAHDIDQVYLNGYGFPAERGGPMAWADDQGLADIHKRLLALETRQGDHWRPAPLIGELA
FT                   ARGKGFYL"
     MSQTSFAIQQ AAVIGAGTMG RGIVMCLANA GVSVQWVDNN PQMLEQALSS VAETYAHNVR        60
     QGRIDQAEAD ARIARVSKAA DYVAIRNVDL VIEAVYENLE LKQKIFRELD GVLKPEALLA       120
     SNTSALDIDA IAAATRRPTQ VLGLHFFSPA HIMKLLEIVR GAQTAPAVLE AALELGKRMG       180
     KVSVVSGNCH GFIGNRMLHP YVLEARKMLL EGAYPHQVDA ALQSFGFAMG PFRMYDVVGI       240
     DLEWRARELA GKGQDAPEVQ VDNRLCEQGR FGQKSGNGYY HYEPGSRQAE HDPEVDALVL       300
     SVSEGLGFHR RDIGSEEILE RCLLALVNEG AKILQEGIAE SAHDIDQVYL NGYGFPAERG       360
     GPMAWADDQG LADIHKRLLA LETRQGDHWR PAPLIGELAA RGKGFYL                     407
//

If you have problems or comments...

PBIL Back to PBIL home page