(data stored in ACNUC7421 zone)

EMBL: CP000094.PE278

CP000094.PE278       Location/Qualifiers
FT   CDS             complement(327352..328191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72024"
FT                   /db_xref="GOA:Q3KJN2"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJN2"
FT                   /protein_id="ABA72024.1"
FT                   /translation="MNAKRPACAAPALETPAPAASQTYSYSDLPLAESASTALAEEVAL
FT                   AIAYNGISQAVMLVTPTDLEDFIVGFSLGSGIIEDASDIYDLQLSGSGSAQYAQVTIAN
FT                   RAFWNLKQQRRQLAGTSGCGLCGVEAVEQALPDLKVLPGAPLPPIEWLDGLRQRIGAFQ
FT                   PLGQHCGAVHAAVFMNASGELLLGREDIGRHNALDKLIGGLIRQKISTAGGLAIVTSRC
FT                   SLELIQKVLRAGIQTLVSLSAPTGLAVQWARRHNLNLIHLPQKNAPRVYSPEMEKHP"
     MNAKRPACAA PALETPAPAA SQTYSYSDLP LAESASTALA EEVALAIAYN GISQAVMLVT        60
     PTDLEDFIVG FSLGSGIIED ASDIYDLQLS GSGSAQYAQV TIANRAFWNL KQQRRQLAGT       120
     SGCGLCGVEA VEQALPDLKV LPGAPLPPIE WLDGLRQRIG AFQPLGQHCG AVHAAVFMNA       180
     SGELLLGRED IGRHNALDKL IGGLIRQKIS TAGGLAIVTS RCSLELIQKV LRAGIQTLVS       240
     LSAPTGLAVQ WARRHNLNLI HLPQKNAPRV YSPEMEKHP                              279
//

If you have problems or comments...

PBIL Back to PBIL home page