(data stored in ACNUC7421 zone)

EMBL: CP000094.PE29

CP000094.PE29        Location/Qualifiers
FT   CDS             31846..32172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71773"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD3"
FT                   /protein_id="ABA71773.1"
FT                   /translation="MQTIKGYHAHVYYDASTIKQARALCEQAAALFPLKMGRVHERPVG
FT                   PHPDWSCQLAFGPELIGDVLPWLALNRKGLVVFLHPDTGDDLLDHTEHAIWMGAMRPLD
FT                   LSVF"
     MQTIKGYHAH VYYDASTIKQ ARALCEQAAA LFPLKMGRVH ERPVGPHPDW SCQLAFGPEL        60
     IGDVLPWLAL NRKGLVVFLH PDTGDDLLDH TEHAIWMGAM RPLDLSVF                    108
//

If you have problems or comments...

PBIL Back to PBIL home page