(data stored in ACNUC7421 zone)

EMBL: CP000094.PE292

CP000094.PE292       Location/Qualifiers
FT   CDS             343619..344287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72038"
FT                   /db_xref="GOA:Q3KJL8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL8"
FT                   /protein_id="ABA72038.1"
FT                   /translation="MTLHYIYDPLCGWCYGAKPLVQAAQQVLPVIAHAGGMMTGANRQS
FT                   VSPQLRNYVMPHDRRIAEYTGQPFGEAYFEGLLRDQSALFDSAPPIAAVMAAEKIDGRG
FT                   LELLGRLQTAHYVEGRRIADESVLVEYAVEQGYNADMFLNALQSVDTEQHIKNSRALLA
FT                   KLGGQGFPTFALEQDGRFTLVDIGPWLGKPEAFAQWLSESFTPAPGTETLPVCGLDGCA
FT                   "
     MTLHYIYDPL CGWCYGAKPL VQAAQQVLPV IAHAGGMMTG ANRQSVSPQL RNYVMPHDRR        60
     IAEYTGQPFG EAYFEGLLRD QSALFDSAPP IAAVMAAEKI DGRGLELLGR LQTAHYVEGR       120
     RIADESVLVE YAVEQGYNAD MFLNALQSVD TEQHIKNSRA LLAKLGGQGF PTFALEQDGR       180
     FTLVDIGPWL GKPEAFAQWL SESFTPAPGT ETLPVCGLDG CA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page