(data stored in ACNUC7421 zone)

EMBL: CP000094.PE293

CP000094.PE293       Location/Qualifiers
FT   CDS             344587..345873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0295"
FT                   /product="putative family S43 non-peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72039"
FT                   /db_xref="GOA:Q3KJL7"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL7"
FT                   /protein_id="ABA72039.1"
FT                   /translation="MLNKRISLIALGMLSATSAMANDQAESKGFVEDSSLKVLLRNAYI
FT                   NRDYKDGNQDKAEWGQAAIGTFSSGFTQGTVGVGVDAFGLYALRLDGGKGRSGAGGIDF
FT                   FKRGDSGNAADDLSKGGAAVKFRISNTVLTYGDQMPALPVLSYDNVRLLPESYTGTLIT
FT                   SKEIKGLQLDAGRFTAESRKSAEGRDSGGLKSINVLGGSYQFTEQFKAALYASDVEDVL
FT                   KKQYVNANYVFPIDKDQSLTLDFNGYRTKLDNSYVRENGVTGDDNKIWSLAATFATGPH
FT                   SFTVAHQRSTGDSNLGYAYGGYQKGQGRVGDGGNTIYLANSYWSDFNAEDERSWQLGYG
FT                   LDFSAFGVPGLSYNFAYVRGDNITTSTSEGGTEREIFNQFKYVVQSGPAKDLSIKLRSS
FT                   ILRVSQKSSEYNVSGNELRVFVDYPINIF"
     MLNKRISLIA LGMLSATSAM ANDQAESKGF VEDSSLKVLL RNAYINRDYK DGNQDKAEWG        60
     QAAIGTFSSG FTQGTVGVGV DAFGLYALRL DGGKGRSGAG GIDFFKRGDS GNAADDLSKG       120
     GAAVKFRISN TVLTYGDQMP ALPVLSYDNV RLLPESYTGT LITSKEIKGL QLDAGRFTAE       180
     SRKSAEGRDS GGLKSINVLG GSYQFTEQFK AALYASDVED VLKKQYVNAN YVFPIDKDQS       240
     LTLDFNGYRT KLDNSYVREN GVTGDDNKIW SLAATFATGP HSFTVAHQRS TGDSNLGYAY       300
     GGYQKGQGRV GDGGNTIYLA NSYWSDFNAE DERSWQLGYG LDFSAFGVPG LSYNFAYVRG       360
     DNITTSTSEG GTEREIFNQF KYVVQSGPAK DLSIKLRSSI LRVSQKSSEY NVSGNELRVF       420
     VDYPINIF                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page