(data stored in ACNUC7421 zone)

EMBL: CP000094.PE294

CP000094.PE294       Location/Qualifiers
FT   CDS             346106..346852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72040"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL6"
FT                   /protein_id="ABA72040.1"
FT                   /translation="MIVLTREVGESLRRDKYANVQGADFNLYGHFADFVRLTKSWENME
FT                   PDSYYGQAEAGMRYRRYSDFEYNPKTRELKQLEHRAYVQSKANNSYVGGVVRHFQDFSD
FT                   EVISSPVMRSLIDTDFEVYKSVLPEELHDEIWQCQIHQIRIEIKPGKQLEITPEGIHCD
FT                   GYPFSGVHFWGRNNVEGAESRLYDIHEQQLASTTYQEILDTTYFLDRDMRHYVTPARNT
FT                   HSHAMAYRQILAISFSRPGTAFDIVR"
     MIVLTREVGE SLRRDKYANV QGADFNLYGH FADFVRLTKS WENMEPDSYY GQAEAGMRYR        60
     RYSDFEYNPK TRELKQLEHR AYVQSKANNS YVGGVVRHFQ DFSDEVISSP VMRSLIDTDF       120
     EVYKSVLPEE LHDEIWQCQI HQIRIEIKPG KQLEITPEGI HCDGYPFSGV HFWGRNNVEG       180
     AESRLYDIHE QQLASTTYQE ILDTTYFLDR DMRHYVTPAR NTHSHAMAYR QILAISFSRP       240
     GTAFDIVR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page