(data stored in ACNUC7421 zone)

EMBL: CP000094.PE296

CP000094.PE296       Location/Qualifiers
FT   CDS             347306..348022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0298"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72042"
FT                   /db_xref="GOA:Q3KJL4"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJL4"
FT                   /protein_id="ABA72042.1"
FT                   /translation="MNETSGSAPLMVDRQPSRTFAEASPVVAGYFTVSFVFGLMAVNAG
FT                   LPLWLPVAMCLFVYAGASQFAALALISSGASLTTIVLTTFLINARHMLMSVYMAKALRA
FT                   LGLSRMERWCYAGGLTDESFAFHSVKLGTGAPVNVRYLIGFNLFCHTSWVIGGLLGALC
FT                   AQYASHLIKYQLDYALTAMMLYVLVSLCNTRNKLIAALAAVVCMGALSLVGSSPFNVFI
FT                   ATFVGCGVGVCLTKRS"
     MNETSGSAPL MVDRQPSRTF AEASPVVAGY FTVSFVFGLM AVNAGLPLWL PVAMCLFVYA        60
     GASQFAALAL ISSGASLTTI VLTTFLINAR HMLMSVYMAK ALRALGLSRM ERWCYAGGLT       120
     DESFAFHSVK LGTGAPVNVR YLIGFNLFCH TSWVIGGLLG ALCAQYASHL IKYQLDYALT       180
     AMMLYVLVSL CNTRNKLIAA LAAVVCMGAL SLVGSSPFNV FIATFVGCGV GVCLTKRS         238
//

If you have problems or comments...

PBIL Back to PBIL home page