(data stored in ACNUC7421 zone)

EMBL: CP000094.PE30

CP000094.PE30        Location/Qualifiers
FT   CDS             complement(32173..32574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71774"
FT                   /db_xref="GOA:Q3KKD2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD2"
FT                   /protein_id="ABA71774.1"
FT                   /translation="MTELHGGGCHCGHIRYQFSGPLHDIAHCHCSICRKVSGGIVTTWI
FT                   TLPAANFQWLTGKPSRYDSSTSCARFFCPNCGAHLALVTLLSPESIDLTIATLDHPEQA
FT                   AAERHIWTDSQLPWLHLDEHLPGEPEETI"
     MTELHGGGCH CGHIRYQFSG PLHDIAHCHC SICRKVSGGI VTTWITLPAA NFQWLTGKPS        60
     RYDSSTSCAR FFCPNCGAHL ALVTLLSPES IDLTIATLDH PEQAAAERHI WTDSQLPWLH       120
     LDEHLPGEPE ETI                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page