(data stored in ACNUC7421 zone)

EMBL: CP000094.PE308

CP000094.PE308       Location/Qualifiers
FT   CDS             complement(356245..356940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0310"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72054"
FT                   /db_xref="GOA:Q3KJK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJK2"
FT                   /protein_id="ABA72054.1"
FT                   /translation="MIIDLYGFGPALFAGALMTVKLALSALCLGLVLGLLGALAKTSPY
FT                   KPLQWLGGTYSTLVRGVPELLWVLLIYFGTVNAMRALGEFLGNPELELSAFAAGVIALG
FT                   LCFGAYATEVFRGAILAIPKGHREAGVALGLSKWRIFTKLIMPQMWRIALPGLGNLFMI
FT                   LMKDTALVSVIGLEEIMRHAQIGVTVSKQPFTFYMVAALMYLGLTVLAMIGMHLLEKRA
FT                   ARGFARSAQ"
     MIIDLYGFGP ALFAGALMTV KLALSALCLG LVLGLLGALA KTSPYKPLQW LGGTYSTLVR        60
     GVPELLWVLL IYFGTVNAMR ALGEFLGNPE LELSAFAAGV IALGLCFGAY ATEVFRGAIL       120
     AIPKGHREAG VALGLSKWRI FTKLIMPQMW RIALPGLGNL FMILMKDTAL VSVIGLEEIM       180
     RHAQIGVTVS KQPFTFYMVA ALMYLGLTVL AMIGMHLLEK RAARGFARSA Q                231
//

If you have problems or comments...

PBIL Back to PBIL home page