(data stored in ACNUC7421 zone)

EMBL: CP000094.PE312

CP000094.PE312       Location/Qualifiers
FT   CDS             complement(360567..361019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ8"
FT                   /protein_id="ABA72058.1"
FT                   /translation="MASLNKQQKRAKRAKAKAKQIRMVGRKPLAQDDDLGHLAEPIPEY
FT                   TLAMFSKMRDAEAVSRNEMLLTLLRELAFIIVDHPDLLDMENAENEGMAATHLAADMLI
FT                   DYRMWADGMDRETAQAWLSEPEFISDFGIALDTYGQSVEAQEEKSE"
     MASLNKQQKR AKRAKAKAKQ IRMVGRKPLA QDDDLGHLAE PIPEYTLAMF SKMRDAEAVS        60
     RNEMLLTLLR ELAFIIVDHP DLLDMENAEN EGMAATHLAA DMLIDYRMWA DGMDRETAQA       120
     WLSEPEFISD FGIALDTYGQ SVEAQEEKSE                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page