(data stored in ACNUC7421 zone)

EMBL: CP000094.PE314

CP000094.PE314       Location/Qualifiers
FT   CDS             complement(361460..362413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72060"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ6"
FT                   /protein_id="ABA72060.1"
FT                   /translation="MNLQSAPPPLGQASDIESEPFHEPAADGYLLGGFTWRHASPDPQR
FT                   PVVIINAATSVRCRHYSRFAAYLFANGFDVIIYDYRGIGESQPKSMRHLQASWTDWGAL
FT                   DFEAMLKRAQREFPGQPIDVVGHSFGGCAAGLGASGQVIRRLVTVGAQFAYWRDYAPGH
FT                   RWRMFGKWHLLMPLVTLLCGYFPGKRLGWLEDTPAGVVRDWSTPAARYERRPSGRTIRN
FT                   LPFANVRAKALAISISDDPYGTIPAIERLLAYFHNAQKTHLRIEPQDIGEQQVGHFAFF
FT                   RSAYQATLWPIALTWLQTGELASDTPGRKIPRSQAL"
     MNLQSAPPPL GQASDIESEP FHEPAADGYL LGGFTWRHAS PDPQRPVVII NAATSVRCRH        60
     YSRFAAYLFA NGFDVIIYDY RGIGESQPKS MRHLQASWTD WGALDFEAML KRAQREFPGQ       120
     PIDVVGHSFG GCAAGLGASG QVIRRLVTVG AQFAYWRDYA PGHRWRMFGK WHLLMPLVTL       180
     LCGYFPGKRL GWLEDTPAGV VRDWSTPAAR YERRPSGRTI RNLPFANVRA KALAISISDD       240
     PYGTIPAIER LLAYFHNAQK THLRIEPQDI GEQQVGHFAF FRSAYQATLW PIALTWLQTG       300
     ELASDTPGRK IPRSQAL                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page