(data stored in ACNUC7421 zone)

EMBL: CP000094.PE315

CP000094.PE315       Location/Qualifiers
FT   CDS             362679..363128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ5"
FT                   /protein_id="ABA72061.1"
FT                   /translation="MKRVLSFVLPVAAAAVLLFPIMAQAASLEPIDSSAVQVQQQEQNG
FT                   VRYLAGGIGEDESKAIQQSAGYNLHMTFAVGMQNQYTADVDVMIQKAPGQTVLTLNQTG
FT                   PLVYVQLPPGKYTVVATRNGETRRDAAEIGGGAARNLVFHWNDNS"
     MKRVLSFVLP VAAAAVLLFP IMAQAASLEP IDSSAVQVQQ QEQNGVRYLA GGIGEDESKA        60
     IQQSAGYNLH MTFAVGMQNQ YTADVDVMIQ KAPGQTVLTL NQTGPLVYVQ LPPGKYTVVA       120
     TRNGETRRDA AEIGGGAARN LVFHWNDNS                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page