(data stored in ACNUC7421 zone)

EMBL: CP000094.PE32

CP000094.PE32        Location/Qualifiers
FT   CDS             34278..35045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0032"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71776"
FT                   /db_xref="GOA:Q3KKD0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKD0"
FT                   /protein_id="ABA71776.1"
FT                   /translation="MEWLTNPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQQR
FT                   TRIFGLGLAMITRILLLLSITWVMRLTADLFEVFGQGISGRDLILFFGGLFLLWKSSQE
FT                   MYHALEGEDESDDEPSGKGGNFLYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMVAAII
FT                   VAVLVMMAASGKISEFIDKHPSLKMLALSFLLVVGTVLIAESFDVHVPKGYVYFAMAFS
FT                   LAVEAINIKMRTAIAKKRKQQDPVKLRKDIPGQ"
     MEWLTNPEIW VAFFTLTALE IVLGIDNIIM ISILVSRMPK HMQQRTRIFG LGLAMITRIL        60
     LLLSITWVMR LTADLFEVFG QGISGRDLIL FFGGLFLLWK SSQEMYHALE GEDESDDEPS       120
     GKGGNFLYTI IQIAIIDIVF SLDSVITAVG MVSHVPVMVA AIIVAVLVMM AASGKISEFI       180
     DKHPSLKMLA LSFLLVVGTV LIAESFDVHV PKGYVYFAMA FSLAVEAINI KMRTAIAKKR       240
     KQQDPVKLRK DIPGQ                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page