(data stored in ACNUC7421 zone)

EMBL: CP000094.PE320

CP000094.PE320       Location/Qualifiers
FT   CDS             367689..369353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0322"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72066"
FT                   /db_xref="GOA:Q3KJJ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJJ0"
FT                   /protein_id="ABA72066.1"
FT                   /translation="MSTTITADGLKADQPGFLSKERIIAKPGFNRWLVPPAALAIHLCI
FT                   GMAYGFSVFWLPLSKALGVTAPVACAPDMSFIAQVFSSQCDWPISMLGWIYTLFFIFLG
FT                   CSAAIWGGWLEHAGPRKAGVVSALCWCGGLLISALGIYTHQIWLMWIGSGVIGGIGLGL
FT                   GYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMVGAPLATALMSHFASPTGVGVWQSFV
FT                   AMAAIYFVFMIGGALAYRVPPTGWKPEGWTAPAKKASNAMITHRHVHVNVAWKTPQFRL
FT                   VWLVLCLNVSAGIGILGMASPLLQEVFGGKLLGNDLPFGQLDAGQLASIAAIAAGFTGL
FT                   LSLFNIGGRFFWASFSDYLGRKNTYFVFFALGFALYALIPNLGHLGNVALFVAAFCIIL
FT                   SMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWAAAGVLGPVLVNYLREYQLSIGVER
FT                   AAAYDITLYILAGLLVLGFLCNLLVRPVADKYFMTDAELAAEQALGHDKGADGSTVLEW
FT                   KAAPGSKPLAIAAWLVVGIPLAWGVWVTLQKTAVLFH"
     MSTTITADGL KADQPGFLSK ERIIAKPGFN RWLVPPAALA IHLCIGMAYG FSVFWLPLSK        60
     ALGVTAPVAC APDMSFIAQV FSSQCDWPIS MLGWIYTLFF IFLGCSAAIW GGWLEHAGPR       120
     KAGVVSALCW CGGLLISALG IYTHQIWLMW IGSGVIGGIG LGLGYISPVS TLIKWFPDKR       180
     GMATGMAIMG FGGGAMVGAP LATALMSHFA SPTGVGVWQS FVAMAAIYFV FMIGGALAYR       240
     VPPTGWKPEG WTAPAKKASN AMITHRHVHV NVAWKTPQFR LVWLVLCLNV SAGIGILGMA       300
     SPLLQEVFGG KLLGNDLPFG QLDAGQLASI AAIAAGFTGL LSLFNIGGRF FWASFSDYLG       360
     RKNTYFVFFA LGFALYALIP NLGHLGNVAL FVAAFCIILS MYGGGFATVP AYLADLFGTQ       420
     MVGAIHGRLL TAWAAAGVLG PVLVNYLREY QLSIGVERAA AYDITLYILA GLLVLGFLCN       480
     LLVRPVADKY FMTDAELAAE QALGHDKGAD GSTVLEWKAA PGSKPLAIAA WLVVGIPLAW       540
     GVWVTLQKTA VLFH                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page