(data stored in ACNUC7421 zone)

EMBL: CP000094.PE322

CP000094.PE322       Location/Qualifiers
FT   CDS             370155..370793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0324"
FT                   /product="imidazole glycerol phosphate synthase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72068"
FT                   /db_xref="GOA:Q3KJI8"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJI8"
FT                   /protein_id="ABA72068.1"
FT                   /translation="MQTVAVIDYGMGNLHSVAKALEHVGAGKVLITSDAAVIREADRVV
FT                   FPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLDSSEENDGVDCIGLFP
FT                   GAVKFFGKDLHEDGEHLKVPHMGWNEVKQAVDHPLWHNIPDLARFYFVHSYYIAAGNPR
FT                   QVVGSGHYGVDFAAALAEGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW"
     MQTVAVIDYG MGNLHSVAKA LEHVGAGKVL ITSDAAVIRE ADRVVFPGVG AIRDCMAEIR        60
     RLGFDSLVRE VSQDRPFLGI CVGMQALLDS SEENDGVDCI GLFPGAVKFF GKDLHEDGEH       120
     LKVPHMGWNE VKQAVDHPLW HNIPDLARFY FVHSYYIAAG NPRQVVGSGH YGVDFAAALA       180
     EGSRFAVQFH PEKSHTHGLQ LLQNFAAWDG RW                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page