(data stored in ACNUC7421 zone)

EMBL: CP000094.PE323

CP000094.PE323       Location/Qualifiers
FT   CDS             370794..371054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72069"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJI7"
FT                   /protein_id="ABA72069.1"
FT                   /translation="MAVKKSKPPILTLTPEQESEANRKIQRFMEDRFELDLGSFEAAEI
FT                   LELFTREIAPHYYNRAIFDVQTHLKERFESIESDLWALEKN"
     MAVKKSKPPI LTLTPEQESE ANRKIQRFME DRFELDLGSF EAAEILELFT REIAPHYYNR        60
     AIFDVQTHLK ERFESIESDL WALEKN                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page