(data stored in ACNUC7421 zone)

EMBL: CP000094.PE325

CP000094.PE325       Location/Qualifiers
FT   CDS             371844..372614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0327"
FT                   /product="imidazole glycerol phosphate synthase subunit"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72071"
FT                   /db_xref="GOA:Q3KJI5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJI5"
FT                   /protein_id="ABA72071.1"
FT                   /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGA
FT                   DEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSIN
FT                   TAAVFNPEFVGEAAQHFGSQCIVVAIDAKKVSGPGETPRWEIFTHGGRKPTGLDAVEWA
FT                   KKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLADGILE
FT                   GHASAVLAASIFHFGEYTVQEAKAYMSKRGIVMR"
     MALAKRIIPC LDVDNGRVVK GVKFENIRDA GDPVEIARRY DEQGADEITF LDITASVDGR        60
     DTTLHTVERM ASQVFIPLTV GGGVRTVQDI RNLLNAGADK VSINTAAVFN PEFVGEAAQH       120
     FGSQCIVVAI DAKKVSGPGE TPRWEIFTHG GRKPTGLDAV EWAKKMEGLG AGEILLTSMD       180
     QDGMKNGFDL GVTRAISDAL GIPVIASGGV GNLQHLADGI LEGHASAVLA ASIFHFGEYT       240
     VQEAKAYMSK RGIVMR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page