(data stored in ACNUC7421 zone)

EMBL: CP000094.PE328

CP000094.PE328       Location/Qualifiers
FT   CDS             complement(374934..375710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0330"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72074"
FT                   /db_xref="GOA:Q3KJI2"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJI2"
FT                   /protein_id="ABA72074.1"
FT                   /translation="MSLRLVFVLLCCLAGAAHAEPARPTPQKAYLTLIIDDLGQNLPRD
FT                   RRVLALPGPVTTAIMPDTPHATEFAREAHRAGKVVILHMPMDPATGPFAWHPELPIEEL
FT                   EKRLNAAFKMVPYTAGINNHMGSRMTAQPVAMAWLMGELQRRHKFFVDSRTSAQTVAAQ
FT                   QAQKIDLASVSRDVFLDDERTEAAILTQLQTAISLAHKQGSAVMIGHPYPQTLAVLERE
FT                   LPKLKAQGIEWIDIKQMISVRSNRATAAHGKNGVYR"
     MSLRLVFVLL CCLAGAAHAE PARPTPQKAY LTLIIDDLGQ NLPRDRRVLA LPGPVTTAIM        60
     PDTPHATEFA REAHRAGKVV ILHMPMDPAT GPFAWHPELP IEELEKRLNA AFKMVPYTAG       120
     INNHMGSRMT AQPVAMAWLM GELQRRHKFF VDSRTSAQTV AAQQAQKIDL ASVSRDVFLD       180
     DERTEAAILT QLQTAISLAH KQGSAVMIGH PYPQTLAVLE RELPKLKAQG IEWIDIKQMI       240
     SVRSNRATAA HGKNGVYR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page