(data stored in ACNUC7421 zone)

EMBL: CP000094.PE332

CP000094.PE332       Location/Qualifiers
FT   CDS             380184..380597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0334"
FT                   /product="putative rhodanese domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72078"
FT                   /db_xref="GOA:Q3KJH8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH8"
FT                   /protein_id="ABA72078.1"
FT                   /translation="MVAHLIEFATNHYILVGIFVVLLALLLAHTVQGGGKSLSTGELTA
FT                   LVNKEAGVVVDIRPSKDYAAGHIVGAVNIPQDKLAARIGELEKHKAKTIILVDALGQTA
FT                   GTHARELMKAGFTAAKLSGGISSWKGDNLPLVK"
     MVAHLIEFAT NHYILVGIFV VLLALLLAHT VQGGGKSLST GELTALVNKE AGVVVDIRPS        60
     KDYAAGHIVG AVNIPQDKLA ARIGELEKHK AKTIILVDAL GQTAGTHARE LMKAGFTAAK       120
     LSGGISSWKG DNLPLVK                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page