(data stored in ACNUC7421 zone)

EMBL: CP000094.PE336

CP000094.PE336       Location/Qualifiers
FT   CDS             381916..382356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72082"
FT                   /db_xref="GOA:Q3KJH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH4"
FT                   /protein_id="ABA72082.1"
FT                   /translation="MHGSEGKDDAHSTPQADPRSKLFPRVMASLAIVGVMVGMMIGRLT
FT                   TPDPTVLQQVEVIDDGLAVWFNNEPKLHGEIVDGSVALLFGAEGKPQKGQLKLNGKDVN
FT                   WRTRLSDGGLLLTLVAARPLQGDWAGQAVDDRWRLEIHLREQ"
     MHGSEGKDDA HSTPQADPRS KLFPRVMASL AIVGVMVGMM IGRLTTPDPT VLQQVEVIDD        60
     GLAVWFNNEP KLHGEIVDGS VALLFGAEGK PQKGQLKLNG KDVNWRTRLS DGGLLLTLVA       120
     ARPLQGDWAG QAVDDRWRLE IHLREQ                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page