(data stored in ACNUC7421 zone)

EMBL: CP000094.PE338

CP000094.PE338       Location/Qualifiers
FT   CDS             complement(384200..385285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0340"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72084"
FT                   /db_xref="GOA:Q3KJH2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH2"
FT                   /protein_id="ABA72084.1"
FT                   /translation="MTISDALHRLLLDNLTTATILLDSELRLEYMNPAAEMLLAISGQR
FT                   SHGQFISELFTESTEALNSLRQAVEQAHPFTKREAMLTALTGQTLTVDYAVTPILSNGA
FT                   TLLLLEVHPRDRLLRITKEEAQLSKQETSKMLVRGLAHEIKNPLGGIRGAAQLLARELP
FT                   EDSLRDYTNVIIEEADRLRNLVDRMLGSNKLPSLALCNVHEVLERVCQLVEAESQGCIT
FT                   LVRDYDPSIPDVLIDREQMIQAVLNIVRNAMQAISSQNELRLGRISLRTRAMRQFTIGH
FT                   VRHRLVTKIEIIDNGPGIPAELQETIFFPMVSGRPDGTGLGLAITQNIISQHQGLIECD
FT                   SHPGHTTFSIFLPLEQGATST"
     MTISDALHRL LLDNLTTATI LLDSELRLEY MNPAAEMLLA ISGQRSHGQF ISELFTESTE        60
     ALNSLRQAVE QAHPFTKREA MLTALTGQTL TVDYAVTPIL SNGATLLLLE VHPRDRLLRI       120
     TKEEAQLSKQ ETSKMLVRGL AHEIKNPLGG IRGAAQLLAR ELPEDSLRDY TNVIIEEADR       180
     LRNLVDRMLG SNKLPSLALC NVHEVLERVC QLVEAESQGC ITLVRDYDPS IPDVLIDREQ       240
     MIQAVLNIVR NAMQAISSQN ELRLGRISLR TRAMRQFTIG HVRHRLVTKI EIIDNGPGIP       300
     AELQETIFFP MVSGRPDGTG LGLAITQNII SQHQGLIECD SHPGHTTFSI FLPLEQGATS       360
     T                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page