(data stored in ACNUC7421 zone)

EMBL: CP000094.PE339

CP000094.PE339       Location/Qualifiers
FT   CDS             complement(385516..386139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72085"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJH1"
FT                   /protein_id="ABA72085.1"
FT                   /translation="MRRGLIALCLSLIAFGASAEVFTYIDAQGNRVYTDQPRGNAKRVP
FT                   LATSNRMASNPTATAPVKPSMKSAEPPLFHYDMLRVLIPEPDATIRSSAGELIVSVTSE
FT                   PGLQKGHLYRLLLDGQAVGEPGLSPVFPLSNIDRGSHNLSVEILDAQGRTVEKTANQPF
FT                   HMQRISLAQKRQVKPCVSADYGVRPECPLKDKPAEPKNPFLRFF"
     MRRGLIALCL SLIAFGASAE VFTYIDAQGN RVYTDQPRGN AKRVPLATSN RMASNPTATA        60
     PVKPSMKSAE PPLFHYDMLR VLIPEPDATI RSSAGELIVS VTSEPGLQKG HLYRLLLDGQ       120
     AVGEPGLSPV FPLSNIDRGS HNLSVEILDA QGRTVEKTAN QPFHMQRISL AQKRQVKPCV       180
     SADYGVRPEC PLKDKPAEPK NPFLRFF                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page