(data stored in ACNUC7421 zone)

EMBL: CP000094.PE346

CP000094.PE346       Location/Qualifiers
FT   CDS             complement(393610..394047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72092"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG4"
FT                   /protein_id="ABA72092.1"
FT                   /translation="MMKPNLIAAAEIDRLDTWAKYSAPMCGSCVSSCCTLPVEVKIKDL
FT                   VRIGVVDEFELGDPPKNIAKRLQKEGLVERFNQKSGIFTLQRMSNNDCYYLDRKSRLCT
FT                   IYDKRPDTCRNHPKIGPRPGYCAYKPKEVERVQNSRSIERF"
     MMKPNLIAAA EIDRLDTWAK YSAPMCGSCV SSCCTLPVEV KIKDLVRIGV VDEFELGDPP        60
     KNIAKRLQKE GLVERFNQKS GIFTLQRMSN NDCYYLDRKS RLCTIYDKRP DTCRNHPKIG       120
     PRPGYCAYKP KEVERVQNSR SIERF                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page