(data stored in ACNUC7421 zone)

EMBL: CP000094.PE348

CP000094.PE348       Location/Qualifiers
FT   CDS             396859..400455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0350"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72094"
FT                   /db_xref="GOA:Q3KJG2"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJG2"
FT                   /protein_id="ABA72094.1"
FT                   /translation="MQWMFMLIGLLLGWLLDESFSDALLGALLGLAIGQAMLIARLGSQ
FT                   AAEQQRQLDHAKIALQGVEQRLFLLEGAPAHSPASPSVAPVSETIVEPVTVFEQPAAAE
FT                   PELVWELPPELEPVAVAASASSQPLPVDVWRLDAVTPEPEPRQPAEPRGPNLIERGISA
FT                   ARNWLFGGNTVLRVGVVLLFFGLAFLLRYATEGMVVPIELRYAGVAAAALGLLALGWWL
FT                   RHRNNSYALMLQGTGIAVLYLTVFAAMRLHPLLDPSAALGLLVAVTVFSAILAITQDSL
FT                   ALACVAALGGFAAPILTSTGAGNHVALFSYFALLNAGILAIAWFKAWRLLNLIGFVGTF
FT                   GIGFAWGLRSYTPELLWSTEPFLILFFLMYLAIGLLFARRKLLDMPDAPADDDREALLH
FT                   WSARKGDYVDGTMLFGPPLVGFGLQFALVQHLEFAAAFSALALGMIYMALAKVLMGGRA
FT                   LLLGETCLALGVIFASLAIPLGLDARWTSAAWAVEGAGIFWLGLRQQRPLARAFALLLQ
FT                   LGSALAFLSQLRVGESSLLDGAPLGALMLGAALLFSFYQLRKASPEQTSPWERQGLPVL
FT                   ACLGLTFLYLLASLFFFIQGTAISWALAGLATLFVGLRLQSRTFLFTAFAVQLLGGALF
FT                   LLRLQGAGEDSAAVFSAGWSGLLSASLIGLALIAGMLLAARDEMVRSDVRLLRGLSVVL
FT                   LAGLVLINLAVLFVLPWQTASAVWAASGLLIIWLSLYLKQRVSFVFGLLLQLIGGAAFL
FT                   LAGPELLGLLSSEGLRPLAHGGFWTPLVLGLAAMIGAWRLQLGNHASAFDVLSLQRLSE
FT                   VLLVWGAGWWALAWVSEVLRFAPQNLQATLLLLVAALSVALWTLLALRLKWPSLGLLCT
FT                   VLIPAAGLVLLGAWHSRYHPAADFGWLVWAAVFVVHFISLRRLAPMLPARALSTAHVLG
FT                   CWLLIGVLALELRYGLLLLSEQYNAWRWLGWAILPSLYLLLMAAPRQWPWPVAAFPREY
FT                   RLYAAAPLAVLMLVWFWLANGVSDGNAEPLPYVPLLNPLELGLLFALFGVYVWSRSAVA
FT                   ELSIRQDYAAYATQLIAGVSLFAFCTALVTRAAHHWAGIPFELDLLLESMLVQAGLSIV
FT                   WTLMALGLMIGGHLRHRREVWLIGAALIALVVAKLIFVELSNRGGLARIVSFIGVGVLL
FT                   LVVGYFAPLPPKRVDAAPAADKPAPETEGVSS"
     MQWMFMLIGL LLGWLLDESF SDALLGALLG LAIGQAMLIA RLGSQAAEQQ RQLDHAKIAL        60
     QGVEQRLFLL EGAPAHSPAS PSVAPVSETI VEPVTVFEQP AAAEPELVWE LPPELEPVAV       120
     AASASSQPLP VDVWRLDAVT PEPEPRQPAE PRGPNLIERG ISAARNWLFG GNTVLRVGVV       180
     LLFFGLAFLL RYATEGMVVP IELRYAGVAA AALGLLALGW WLRHRNNSYA LMLQGTGIAV       240
     LYLTVFAAMR LHPLLDPSAA LGLLVAVTVF SAILAITQDS LALACVAALG GFAAPILTST       300
     GAGNHVALFS YFALLNAGIL AIAWFKAWRL LNLIGFVGTF GIGFAWGLRS YTPELLWSTE       360
     PFLILFFLMY LAIGLLFARR KLLDMPDAPA DDDREALLHW SARKGDYVDG TMLFGPPLVG       420
     FGLQFALVQH LEFAAAFSAL ALGMIYMALA KVLMGGRALL LGETCLALGV IFASLAIPLG       480
     LDARWTSAAW AVEGAGIFWL GLRQQRPLAR AFALLLQLGS ALAFLSQLRV GESSLLDGAP       540
     LGALMLGAAL LFSFYQLRKA SPEQTSPWER QGLPVLACLG LTFLYLLASL FFFIQGTAIS       600
     WALAGLATLF VGLRLQSRTF LFTAFAVQLL GGALFLLRLQ GAGEDSAAVF SAGWSGLLSA       660
     SLIGLALIAG MLLAARDEMV RSDVRLLRGL SVVLLAGLVL INLAVLFVLP WQTASAVWAA       720
     SGLLIIWLSL YLKQRVSFVF GLLLQLIGGA AFLLAGPELL GLLSSEGLRP LAHGGFWTPL       780
     VLGLAAMIGA WRLQLGNHAS AFDVLSLQRL SEVLLVWGAG WWALAWVSEV LRFAPQNLQA       840
     TLLLLVAALS VALWTLLALR LKWPSLGLLC TVLIPAAGLV LLGAWHSRYH PAADFGWLVW       900
     AAVFVVHFIS LRRLAPMLPA RALSTAHVLG CWLLIGVLAL ELRYGLLLLS EQYNAWRWLG       960
     WAILPSLYLL LMAAPRQWPW PVAAFPREYR LYAAAPLAVL MLVWFWLANG VSDGNAEPLP      1020
     YVPLLNPLEL GLLFALFGVY VWSRSAVAEL SIRQDYAAYA TQLIAGVSLF AFCTALVTRA      1080
     AHHWAGIPFE LDLLLESMLV QAGLSIVWTL MALGLMIGGH LRHRREVWLI GAALIALVVA      1140
     KLIFVELSNR GGLARIVSFI GVGVLLLVVG YFAPLPPKRV DAAPAADKPA PETEGVSS        1198
//

If you have problems or comments...

PBIL Back to PBIL home page