(data stored in ACNUC7421 zone)

EMBL: CP000094.PE352

CP000094.PE352       Location/Qualifiers
FT   CDS             complement(403832..405724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0354"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72098"
FT                   /db_xref="GOA:Q3KJF8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJF8"
FT                   /protein_id="ABA72098.1"
FT                   /translation="MTRNMKFSHKILLAAALVVAVAFACFILFNDYRQREALQSSTEAS
FT                   MQELGSLTTSNIQTWLESRIQLLQSMSQQVVADGNAPASLKRIIDLPAYTGNFQLSYFG
FT                   GADGVMFSVPAGNRAPDYDPRARGWYKAANAAQQTIVTEPYIAASSGKLVITVATPVQR
FT                   QGQMIGVAGADIDLSSVSAIINSLNFGGHGHAFIVSADGKILIHPDSKLVLKTLAEAYP
FT                   NGAPNVSPGLKEVEFDGKTQLISFTRVNGVPSADWYVALVLDKDTAFSMLSEFRTSALI
FT                   AMVIAVVIIIALLGMLIRVLMQPLLTMGRAMHDIAEGEGDLTKRLTIHGHDEFGALGLS
FT                   FNRFVERIHTSIREVSSATGQVNEVALRVVAASNSSMFNSDQQASRTNSVAAAINQLGA
FT                   AAQEIAQNAALASQHSSDARSLAEDGQQVVDKTIHAMQQLSAKISDSCGNIETLNSNTV
FT                   NIGQILEVITSISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAHRTQDSAQQVQ
FT                   KMIEELQVGARQAVGIMTESQRESESSVGIANQAGERLGSVTQRIGEIDGMNQSVATAT
FT                   EEQTAVVESINVDINEINTLNQEGVENLQATLRACADLEQQAARLKQLVGSFRI"
     MTRNMKFSHK ILLAAALVVA VAFACFILFN DYRQREALQS STEASMQELG SLTTSNIQTW        60
     LESRIQLLQS MSQQVVADGN APASLKRIID LPAYTGNFQL SYFGGADGVM FSVPAGNRAP       120
     DYDPRARGWY KAANAAQQTI VTEPYIAASS GKLVITVATP VQRQGQMIGV AGADIDLSSV       180
     SAIINSLNFG GHGHAFIVSA DGKILIHPDS KLVLKTLAEA YPNGAPNVSP GLKEVEFDGK       240
     TQLISFTRVN GVPSADWYVA LVLDKDTAFS MLSEFRTSAL IAMVIAVVII IALLGMLIRV       300
     LMQPLLTMGR AMHDIAEGEG DLTKRLTIHG HDEFGALGLS FNRFVERIHT SIREVSSATG       360
     QVNEVALRVV AASNSSMFNS DQQASRTNSV AAAINQLGAA AQEIAQNAAL ASQHSSDARS       420
     LAEDGQQVVD KTIHAMQQLS AKISDSCGNI ETLNSNTVNI GQILEVITSI SQQTNLLALN       480
     AAIEAARAGE AGRGFAVVAD EVRNLAHRTQ DSAQQVQKMI EELQVGARQA VGIMTESQRE       540
     SESSVGIANQ AGERLGSVTQ RIGEIDGMNQ SVATATEEQT AVVESINVDI NEINTLNQEG       600
     VENLQATLRA CADLEQQAAR LKQLVGSFRI                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page