(data stored in ACNUC7421 zone)

EMBL: CP000094.PE36

CP000094.PE36        Location/Qualifiers
FT   CDS             40070..41098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0036"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71780"
FT                   /db_xref="GOA:Q3KKC6"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC6"
FT                   /protein_id="ABA71780.1"
FT                   /translation="MSKLTLLIQRILELMKRYPGVIALGGFISGVGSFILVDRQQGLAS
FT                   WITTIMLLSWIWLMLENSLTRLFTRIFKREIPQPLLRYATQMIHQESLFFVLPFFFITT
FT                   TWNSGQLFFTGLLCIAALISIVDPLYYKWLAPRRWAFLALHTLTLFAALLTALPVIMHL
FT                   TTSQSFKWALGIAVLLSFPSLASIFPIRTVRNALAILCITVGIGGVGWVLRSWVPPATL
FT                   WMTDVAISTQVQDRVPGASLKEVSAEQIRGGGLYAYTAINAPRGLDERIYHVWQFNGKE
FT                   VDRIALDIHGGRKEGYRAWTHKQNFPGNPAGKWQVRVLTEDGQVIGVLRFEVTDSTPTK
FT                   EK"
     MSKLTLLIQR ILELMKRYPG VIALGGFISG VGSFILVDRQ QGLASWITTI MLLSWIWLML        60
     ENSLTRLFTR IFKREIPQPL LRYATQMIHQ ESLFFVLPFF FITTTWNSGQ LFFTGLLCIA       120
     ALISIVDPLY YKWLAPRRWA FLALHTLTLF AALLTALPVI MHLTTSQSFK WALGIAVLLS       180
     FPSLASIFPI RTVRNALAIL CITVGIGGVG WVLRSWVPPA TLWMTDVAIS TQVQDRVPGA       240
     SLKEVSAEQI RGGGLYAYTA INAPRGLDER IYHVWQFNGK EVDRIALDIH GGRKEGYRAW       300
     THKQNFPGNP AGKWQVRVLT EDGQVIGVLR FEVTDSTPTK EK                          342
//

If you have problems or comments...

PBIL Back to PBIL home page