(data stored in ACNUC7421 zone)

EMBL: CP000094.PE362

CP000094.PE362       Location/Qualifiers
FT   CDS             415410..416240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0364"
FT                   /product="putative histidine ABC transport system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72108"
FT                   /db_xref="GOA:Q3KJE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE8"
FT                   /protein_id="ABA72108.1"
FT                   /translation="MSNATVSKIEVKNVFKIFGNRAKDALAMVGQGKTKDQVLNETGCV
FT                   VGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGVDILQYDMDAL
FT                   REFRRHKISMVFQSFGLLPHKTVLDNVAYGLKVRGESKQLCAERALHWINTVGLKGYEN
FT                   KYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTI
FT                   VFITHDLDEAVRIGNRIAILKDGRLIQVGTPKEILHSPADEYVDRFVQRRAAVV"
     MSNATVSKIE VKNVFKIFGN RAKDALAMVG QGKTKDQVLN ETGCVVGVND LSLSIGTGEI        60
     FVIMGLSGSG KSTLVRHFNR LIDPTSGAIL VDGVDILQYD MDALREFRRH KISMVFQSFG       120
     LLPHKTVLDN VAYGLKVRGE SKQLCAERAL HWINTVGLKG YENKYPHQLS GGMRQRVGLA       180
     RALAADTDII LMDEAFSALD PLIRAEMQDQ LLELQKTLHK TIVFITHDLD EAVRIGNRIA       240
     ILKDGRLIQV GTPKEILHSP ADEYVDRFVQ RRAAVV                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page