(data stored in ACNUC7421 zone)

EMBL: CP000094.PE367

CP000094.PE367       Location/Qualifiers
FT   CDS             421913..422929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0369"
FT                   /product="putative glycine betaine/L-proline-binding
FT                   protein ABC transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72113"
FT                   /db_xref="GOA:Q3KJE3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJE3"
FT                   /protein_id="ABA72113.1"
FT                   /translation="MFRPRCKKTPIRTIIRCRTRRSLMKKLFTRCALILTGSALLSAGA
FT                   MASDDASCKTVRMGVVNWTDVIATSGMADVLLNGLGYESKQTSAVQQIIFAGIRDKRLD
FT                   IFLGYWKPAMDKNIAPFLAANQVKVMDKPSLADAQATLAVPDYVAAAGLKTFGDIAKFK
FT                   DQLGGKIYGIEPGSGANTTIKTMIETNHFGLKDFKIIESGEAGMLAAVQRAVNRKEFVV
FT                   FVGWTPHPMNINMKITYLTGSEDVYGPNEGAATVSTVTAPDYAERCPNVHRLLENLTFT
FT                   AAQESQLMVPIMERKTPQEVAKTWLREHPEDLQRWLAGVSSFDGKDGVATVQASLKN"
     MFRPRCKKTP IRTIIRCRTR RSLMKKLFTR CALILTGSAL LSAGAMASDD ASCKTVRMGV        60
     VNWTDVIATS GMADVLLNGL GYESKQTSAV QQIIFAGIRD KRLDIFLGYW KPAMDKNIAP       120
     FLAANQVKVM DKPSLADAQA TLAVPDYVAA AGLKTFGDIA KFKDQLGGKI YGIEPGSGAN       180
     TTIKTMIETN HFGLKDFKII ESGEAGMLAA VQRAVNRKEF VVFVGWTPHP MNINMKITYL       240
     TGSEDVYGPN EGAATVSTVT APDYAERCPN VHRLLENLTF TAAQESQLMV PIMERKTPQE       300
     VAKTWLREHP EDLQRWLAGV SSFDGKDGVA TVQASLKN                               338
//

If you have problems or comments...

PBIL Back to PBIL home page