(data stored in ACNUC7421 zone)

EMBL: CP000094.PE373

CP000094.PE373       Location/Qualifiers
FT   CDS             430418..431215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0375"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72119"
FT                   /db_xref="GOA:Q3KJD7"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD7"
FT                   /protein_id="ABA72119.1"
FT                   /translation="MKKYLSMLLVGVTALVAVNAAQAGAIDDAVKRGSLKVGMDPTYMP
FT                   FEMTNKRGEIIGFEVDILKAMTKAMGVKLELVSTGYDGIIPALMTDKFDMIGSGMTLTQ
FT                   ERNLRLNFSEPFIVVGQTLLIRKELEGTIKSYKDLNTADYRITSKLGTTGEMVAKKLIS
FT                   KAKYHGYDNEQEAVLDVVNGKADAFIYDAPYNVVAVNKVGAGKLVFLDKPFTYEPLAFG
FT                   LKKGDYDSLNFINNFLHQIHEDGTYDRIHDKWFKSTEWLKDME"
     MKKYLSMLLV GVTALVAVNA AQAGAIDDAV KRGSLKVGMD PTYMPFEMTN KRGEIIGFEV        60
     DILKAMTKAM GVKLELVSTG YDGIIPALMT DKFDMIGSGM TLTQERNLRL NFSEPFIVVG       120
     QTLLIRKELE GTIKSYKDLN TADYRITSKL GTTGEMVAKK LISKAKYHGY DNEQEAVLDV       180
     VNGKADAFIY DAPYNVVAVN KVGAGKLVFL DKPFTYEPLA FGLKKGDYDS LNFINNFLHQ       240
     IHEDGTYDRI HDKWFKSTEW LKDME                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page